SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|325909|NCBI_GNO_7400015 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|325909|NCBI_GNO_7400015
Domain Number 1 Region: 373-550,585-748
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.75e-79
Family YicI catalytic domain-like 0.0005
Further Details:      
 
Domain Number 2 Region: 127-371
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-40
Family YicI N-terminal domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 751-831
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-20
Family Putative glucosidase YicI, domain 3 0.0038
Further Details:      
 
Domain Number 4 Region: 104-148
Classification Level Classification E-value
Superfamily Trefoil 0.000000241
Family Trefoil 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|325909|NCBI_GNO_7400015
Sequence length 964
Sequence
MKLGFWKSEKVKNHESLVENEVLDFHVESTSKVVHKARIFPVWISWILSLVLGIFVILLW
ILLDLHVDALWSQRQETVAILVDQLEELEFLISATEKTGSSCPYDVEDELKFDCFPQGNA
DENLCLKRGCCWSFTEKQSVPFCYYPSNYALYSFINVTQLNNSKVNGVVGYLKQTGYSGY
PEEIPLLKLMATFETNNRLRVKIVDAMNKRYEVNVLDSLEAEDVLPVHDYDYTFSVNTDI
TGFSIARKSNQEVIFSTVGVGGFIYANQFLQISSFLPSGNIYGLGEHQDSLRHSTNWQRF
ALFNHDTVPDKGRNLYGSHPFYLVMENDGLSHGVFLKNSDPMEVILQPTPAITFRALGGI
IDFYFFLGPTPQEVIEQYTEVIGRPAMPPYWGLGFHLCRYNYGSLNRTREIWERTRAAGI
PFDVQWNDLDYMDTAKDFTYDRNTFAGLPEFVREVHSVGMHYIPLIDPGISNTESKLEYP
PYDEGIAMNVFVKNSVDPDALPFVGKVWNTVSTVWPDFTHPNATEYWTNQLKTFHNEVPF
DGAWIDMNEPSNFYSGTIDGCPATKWDNPPYTPAVVGDKLCFLTLCMSAGQYGGIHYDLH
NLYGFTETIATNFALKQIRGKRPFIISRSTFPGQGHYGGHWSGDVVSDWTNLRRSITSIL
NYNMFGIPLVGADICGFNGNTTAALCQRWMELGAFYPFSRNHNTDDGIDQDPVALGPAVV
EASRKALMVRYMLLPYLYTLFWHAHAHGRTVARPLFFEFPSDRQTYTIDTQFLWGAGLMV
APVLSASTEIIEVYLPRSLWYDFYNLQLISAGGKWTSLPAPLDTIPILLRGGYILPTQAP
EVTTALTRVKPFDLLVALNETKQAAGDLYCDDGDTNDAYLLSQFNFIQFEASSNMIKSSV
VNWNIESSSSTVRDVTVLGLSDPVSVVTVNGIPHSSFTFNTIKKVLFLKDLKLHLKNPFV
ISYQ
Download sequence
Identical sequences E9H648
jgi|Dappu1|325909|NCBI_GNO_7400015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]