SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|333491|NCBI_GNO_24000010 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|333491|NCBI_GNO_24000010
Domain Number 1 Region: 258-365
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000271
Family Tetratricopeptide repeat (TPR) 0.0086
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|333491|NCBI_GNO_24000010
Domain Number - Region: 32-96
Classification Level Classification E-value
Superfamily TPR-like 0.0126
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|333491|NCBI_GNO_24000010
Sequence length 440
Sequence
MAEIPTTTNGTSSETASASGPVESSSDKEQVTKEAMNLLEQGRRYLHVSDLPSAISALAE
SVKLLVKQYGANADECAESFYYLGMAFHEKHRADSCVLDEPFTFTIRPLSLPSEKSEEEE
DSGENSTNGDVETNGKTGKPDDSEVKEKTKVADEISTTESTESKPENAEPTASEAASVAK
APVVEMKNSEPSSEHTNRNKSESKAEEKTDTAQNGEKSVVKLRNEAKGKSLKAAGSSSGE
KVDSVADDDDEDEKPILLLAWEQFEQAKIIYERKVEKDPAVEPKLADVLFRLAEVELEAE
DFTKAIEDLQKYLKIQKASLPPDSRSLSETHYKLGVAFNSTSKFKDAVRSFESAANIIKH
RINILKNPTKEKPSMEEPKSAFYTAEGEIEDLKSLLPDLHSKIAVNINLENQEMKNATRK
KRDPDDNAGTEPVFKLPKVA
Download sequence
Identical sequences E9HSZ5
jgi|Dappu1|333491|NCBI_GNO_24000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]