SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|342166|NCBI_GNO_688900001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|342166|NCBI_GNO_688900001
Domain Number 1 Region: 325-390
Classification Level Classification E-value
Superfamily TPR-like 0.000000002
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|342166|NCBI_GNO_688900001
Sequence length 582
Sequence
MDALEAARSIRAASYQEPDVDGVTSEDGDQAEAHNEDDDQDEVDDEDNQLAEPRTYQQWL
DAVLESKYELEAVPPEILDDAMVDAAIDADVEALDYLPAQWRSPERMAAIVRKSASDAAS
IPVRCMTTEALALARSLYADDADWHWRDDRNSSKPSEWDKNSLYDVWGCLLDEEDCLKAV
KAGVALNNVPDALWTERVERAALEADIYNISYIAKHKITPELARRAVQHSYGKLIESIPR
ELLTPALCMASVKCNGMSLEFVPEEMRTVEVCIAALQEDRRVFFAVPTALELEVLSKLIE
IKTAELQKKNEDELAGEAVDAVPATEWHAYRAWAKLWAKDYQGAIEDARLALQVAPYPQH
AHYVMADALRAQGRMEEAALEAATVLSLQDPYEAEFNENTDTSWLQDISKTQFDQMDAAA
LLQAIGSHPLTLADVPRARIDETLVATALAADPDAIAFVPKRLMNPARYAMALERRTKQL
QHVPAPMLSEAACITHVSTYGRLAEVPLPWRTATVCANALLRASYVTDHVPDAVKDETKQ
LLAKLKLEAGVDEEQEANEVSEPSKTSELMTNALLQTPGRSA
Download sequence
Identical sequences E9I5S9
jgi|Dappu1|342166|NCBI_GNO_688900001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]