SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194735724|ref|YP_002116176.1| from Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194735724|ref|YP_002116176.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.58e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.24e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000941
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194735724|ref|YP_002116176.1|
Sequence length 672
Comment FAD/FMN-binding/pyridine nucleotide-disulfide oxidoreductase family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDITGVTLKLNQQVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
SGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0L5XQF4 A0A0N1TUX1 A0A271CEI8 A0A2J9MKY0 G4C333
ABEJ01000014|CDS_12707-14725 CP001127|CDS_3293782-3295800 gi|194735724|ref|YP_002116176.1| 439843.SeSA_A3410 WP_000121532.1.101147 WP_000121532.1.10164 WP_000121532.1.12877 WP_000121532.1.13528 WP_000121532.1.13827 WP_000121532.1.14296 WP_000121532.1.15054 WP_000121532.1.16804 WP_000121532.1.17270 WP_000121532.1.18277 WP_000121532.1.19174 WP_000121532.1.19405 WP_000121532.1.20810 WP_000121532.1.21260 WP_000121532.1.21473 WP_000121532.1.22966 WP_000121532.1.24412 WP_000121532.1.24521 WP_000121532.1.25397 WP_000121532.1.25708 WP_000121532.1.26034 WP_000121532.1.26213 WP_000121532.1.26833 WP_000121532.1.27655 WP_000121532.1.2806 WP_000121532.1.28174 WP_000121532.1.28921 WP_000121532.1.28963 WP_000121532.1.30225 WP_000121532.1.3066 WP_000121532.1.3185 WP_000121532.1.32357 WP_000121532.1.32643 WP_000121532.1.34022 WP_000121532.1.37100 WP_000121532.1.37808 WP_000121532.1.39059 WP_000121532.1.40693 WP_000121532.1.42356 WP_000121532.1.43654 WP_000121532.1.44339 WP_000121532.1.45402 WP_000121532.1.48647 WP_000121532.1.49090 WP_000121532.1.52456 WP_000121532.1.5525 WP_000121532.1.56069 WP_000121532.1.56413 WP_000121532.1.57495 WP_000121532.1.57857 WP_000121532.1.58334 WP_000121532.1.59755 WP_000121532.1.61737 WP_000121532.1.63782 WP_000121532.1.67731 WP_000121532.1.70183 WP_000121532.1.70281 WP_000121532.1.70355 WP_000121532.1.7044 WP_000121532.1.7093 WP_000121532.1.70986 WP_000121532.1.71088 WP_000121532.1.71450 WP_000121532.1.71583 WP_000121532.1.72438 WP_000121532.1.74469 WP_000121532.1.74757 WP_000121532.1.74876 WP_000121532.1.76611 WP_000121532.1.78789 WP_000121532.1.8024 WP_000121532.1.80496 WP_000121532.1.80803 WP_000121532.1.81118 WP_000121532.1.82562 WP_000121532.1.84115 WP_000121532.1.84325 WP_000121532.1.84523 WP_000121532.1.85797 WP_000121532.1.90991 WP_000121532.1.92836 WP_000121532.1.96404 WP_000121532.1.98403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]