SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190150959|ref|YP_001969484.1| from Actinobacillus pleuropneumoniae serovar 7 str. AP76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190150959|ref|YP_001969484.1|
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily MtlR-like 1.96e-51
Family MtlR-like 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|190150959|ref|YP_001969484.1|
Sequence length 174
Comment hypothetical protein APP7_1690 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
Sequence
MPYSDNFIEQLSEVPSLRGFFALSVNQFAQNIERLIQRVFRKTDFALKSVVDSLFEHQGP
LAELTVRLKLLLGLGVISAAVFEDISLFIEVKQQLSDEVDELPFSHPAIVQFARDLHHID
LSPVSELLKFASSVENKDSMLYQMQQIRLERVMRSSLILAITEINEKLNVESPL
Download sequence
Identical sequences B3H2M5 E0FPQ6
537457.APP7_1690 WP_005618099.1.44215 WP_005618099.1.45850 WP_005618099.1.67471 gi|190150959|ref|YP_001969484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]