SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297564567|ref|YP_003683539.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564567|ref|YP_003683539.1|
Domain Number 1 Region: 142-334,475-587
Classification Level Classification E-value
Superfamily Subtilisin-like 1.27e-75
Family Subtilases 0.0000745
Further Details:      
 
Domain Number 2 Region: 379-426
Classification Level Classification E-value
Superfamily PA domain 0.000000000122
Family PA domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297564567|ref|YP_003683539.1|
Sequence length 860
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Meiothermus silvanus DSM 9946]
Sequence
MRRFLLLSLGLLLLAACGGPEPQVRSGVEVIANAPQAPESGQLVNETPTRWIVELSGQSV
SDGVSLQSVEAQHAVFRQAAETAGIKIRYAYTDLFNGFSVELPKGSSPNKLYTLPGVVAI
YPVHILALPPTQRVEPDLATAITQTGVDIAQNDLGLTGKGVKVGIIDSGIDLQHPAFAGR
IIEGYDFVGDDYNAADPAHSTPVPDPNPDDCGGHGTHVAGIVGGKDSQITGVAPGVKFGA
YKVFGCEGSTSDDVILAALERAERDDMDIVNMSLGSPYGWSALVKGINKLVKKGVVVVAS
AGNEGASGLFTTGAPAAATDVISVASFDNITVQLRTFTISPDNRTVGYFLASGSIPAPTS
GSSPVVVASPLNGCNVNGANPFAPGTFSGKAVLIQRGICTFREKALNAEAAGAVAVLIYN
NRPGYLQGTIGGPISVPVVMLSDSDGATIAARSNVTLTWSNVEARFPLATGNLISSFSSW
GLSQDLEFKPDLGAPGGFIRSAFPLEQGGYAVLSGTSMSSPHVAGAAALLLEGNPAFAHG
QRPALVRTMLQNTAYPKPFSLAPSSGFAESSFREGSGMIDVLGAVQTRITVTPSKISFAE
VNGAYTQTLTLKNRSNVPTIYKLVHVPGISATGSVYAPSFVTGFANVTFSANQITVPAQG
ETTVSVSITPNPGLASKSLYGGYILFQPVGAGVGLNVPYVGLQGGYKSIRVLEPTPFGFP
WLADASFNQLSGGTFTLQGEDKPYLLFHFEHGAQIYQVVILNGQTGKPIHPKFNKADLAW
FTDRNSTRTGIFTLAWDGTYISKYKETEVYNTDIPIPAEFKPVPNGIYRLQIEVLKPTGN
KNNPADWETWTSPAFTIARP
Download sequence
Identical sequences D7BGB0
gi|297564567|ref|YP_003683539.1| WP_013156639.1.93385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]