SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297565571|ref|YP_003684543.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297565571|ref|YP_003684543.1|
Domain Number 1 Region: 304-525
Classification Level Classification E-value
Superfamily PHP domain-like 2.09e-46
Family PHP domain 0.0033
Further Details:      
 
Domain Number 2 Region: 171-280
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000000563
Family DNA polymerase beta-like 0.056
Further Details:      
 
Domain Number 3 Region: 59-142
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000000188
Family Achaeal helicase C-terminal domain 0.004
Further Details:      
 
Domain Number 4 Region: 5-80
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000017
Family DNA polymerase beta, N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297565571|ref|YP_003684543.1|
Sequence length 532
Comment PHP domain-containing protein [Meiothermus silvanus DSM 9946]
Sequence
MNRKELSGLLEYAADLLEVLGEHAFRAPAYRRVARVLERSETDLETLAARNFEGIAGPSL
APMLVEIVQSGEFPYLAELESRIPPGVLEMFRVRGLGPKRIRALWDNHVDSLEELIRHAE
EGKLRGIPGFGAKTEQNLLEAARFALENLRRVLLPVGLGAAQLLLTDLAGAGIQAELTGS
LRRGLETVGNVDLIALAEPEAAAKALGQYAEGVEGQVIHGRVEGVRLRVFCADRASYGTT
LFRTTGSIPWLSELGALPLAPDEESVFAALGKPYVPPFWREPEHIGLNPPGRLVQREELA
GLIHNHTTYSDGTASLREMAEAAIERGYEYMVISDHSQSAPYAGGLEPPRLLEQWKEIEA
LNAELAPFRILKGIESDILPDGSLDYPDEVLQKFDVVIGSIHSGFGLSYEAQTERLLRAV
DNPYLSILGHATGRLLLRRKGVEANWERVLERAEQNKVIVEINCNPYRLDLDWRWALRWR
ERLVFSLGPDSHAISGMDDIGYGLLMSHKAGLSPERVVNTWKAEELIGYRKS
Download sequence
Identical sequences D7BDB7
WP_013157615.1.93385 gi|297565571|ref|YP_003684543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]