SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297566056|ref|YP_003685028.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297566056|ref|YP_003685028.1|
Domain Number 1 Region: 9-544
Classification Level Classification E-value
Superfamily Urocanase 2.22e-238
Family Urocanase 0.00000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297566056|ref|YP_003685028.1|
Sequence length 547
Comment urocanate hydratase [Meiothermus silvanus DSM 9946]
Sequence
MTYKAPRGPKTAKGWIQEAAKRMLLNNLDPEVAEKPEELIVYGGRGKAARSPQDLQRILE
VLERLENDETLLVQSGRAVGVFKTQPLAPRVILANSNLVPKWATWEEFDRLDRLGLMMYG
QMTAGSWIYIGTQGILQGTYETFAAAARKHFGGSLKGTVTVTGGLGGMGGAQPLAVTLNG
GVAICVEIDPERIQRRLDTAYLDVRADSLDEALRLAEEAKQGGEPLSIGLLGNTAQVLPE
MVRRGFTPELVTDQTSAHDPLYGYIPVLHADEDPDTLRKTDPQGYKARVLDSMAEHCRSI
VEMQKRGAVAFDYGNNLRAFAKEGGFEEAFSYPGFVPAFIRDQFCEGRGPFRWVALSGRP
EDIYKTDKAVLELFPEDEGLRRWLTEGVKKFKFQGLPARICWLGYKERDKAGLLFNEMVA
KGEVGAPIVIGRDHLDAGSVASPYRETEAMLDSSDAVADWPLLNFALNAVSGAGWVSFHH
GGGVGMGYSLHAGQVTVADGSQEAAYRLERVLTNDPGTGVMRHAHAGYDSAKEVARERGL
DLAGWEK
Download sequence
Identical sequences D7BFG7
WP_013158082.1.93385 gi|297566056|ref|YP_003685028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]