SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297566309|ref|YP_003685281.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297566309|ref|YP_003685281.1|
Domain Number - Region: 5-98
Classification Level Classification E-value
Superfamily Ribosomal protein S7 0.0153
Family Ribosomal protein S7 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297566309|ref|YP_003685281.1|
Sequence length 103
Comment hypothetical protein [Meiothermus silvanus DSM 9946]
Sequence
MNKPISFEQSQDAIDAITSDLTLQPEKYLYYALHDLASDLIYAARQLKETGELEPAQLKF
VARRALAAYVASEQIFDAKNRETDEKIQDILRNPHRTKGMEMP
Download sequence
Identical sequences D7BGF7
WP_013158329.1.93385 gi|297566309|ref|YP_003685281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]