SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297566358|ref|YP_003685330.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297566358|ref|YP_003685330.1|
Domain Number 1 Region: 16-393
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.09e-109
Family Homocysteine S-methyltransferase 0.00000281
Further Details:      
 
Domain Number 2 Region: 955-1223
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.31e-81
Family Methionine synthase SAM-binding domain 0.0004
Further Details:      
 
Domain Number 3 Region: 351-617
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.97e-73
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00077
Further Details:      
 
Domain Number 4 Region: 739-868
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.22e-37
Family Cobalamin (vitamin B12)-binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 652-733
Classification Level Classification E-value
Superfamily Methionine synthase domain 8.5e-24
Family Methionine synthase domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297566358|ref|YP_003685330.1|
Sequence length 1223
Comment methionine synthase [Meiothermus silvanus DSM 9946]
Sequence
MTHLGYQREARAEAFPYLRALSERVLIYDGAMGTEIFKYDLSAADYGAEQYNGCPEMLNR
TRPDVIEAIHKSYLEAGADVIETNTFGAFPHVLVEYGLEAEAYELAFAGAHLARRVADEH
STPDQPRFVAGSMGPGTKLISLGQISWEGLFESYRVCAQGLLDGGVDLILIETCQDILQV
RCAVLAARRAMKDVGREVPIQVQVTMETTGTMLVGTDDAAALTVLEALPIDVVGFNCATG
PDLMDTHVRFFCENATRWVSCLPNAGLPRNEGGRVVYDLTPAELARWQQKFVNEYGLNVV
GGCCGTGPEHIRALAQALRRQPQKANRQGQFPAQVASLYQAIPLKQDTGILIVGERTNAT
GSKKFRELLFAEDWEGMLELAQEQVAEGAHVLDVSVAWTGRDEVRDMREVVKRFATSVQI
PIMIDSTQTDVMQAALEHLGGRAILNSVNLEDGLEKFDRVASLARQHGAALVALTIDEDK
EAGMAKTPERKVEIALRMYERLTQVHGIPGSSILFDLLTFPITQGDEDTRKLAMWTIEGI
RRVRELLPEVGFILGISNVSFGLSPQARVVLNSVFLDECIKAGLTAAILNAGKIRPINQI
PEEQYQLALDLIYDRRTFNPDGSVAHDPLFAFVDYFAKNKVERSSAADPFTGLSVEERLK
KRIIEGRKVGLEADLESALQAGYTPVSLINEVLLEGMKVVGDLFGAGKMQLPFVLQAAET
MKAAVRYLEPKMDRLEGVHKGTMVLATVKGDVHDIGKNLVDIILSNNGYKVVNLGIKKPI
EEILAAVEEHRPQAVGMSGLLVKSTVVMKENLEYMRERGYRIPVILGGAALNRHYVENDL
RQTYTTGTVYYASDAFDGLQLMDELCGHAPPKLTSRFQSGHKYKTAYEILMEKLEAGSEY
VPSNIPPAARIPRPPFWGRQVVRSGVGKTLPQRAGRLETQGRFPSGRRSRTPGGELDLGV
IAQYVNKNALFRGQWGFRRGEMDKAEYAHKLEREAEPIFRELLDQAMREGTLEPAVAYGF
WPVASDKNKLVVFDPESGAELFAFDFPRQMGQNSRHLCIADFFRPRYADAVGDEESWIPR
AAWENGARDVLGCQVVTMGRTASEYAAKLFSSDRYQDYLYWHGFSVEMAEALAEYWHKRV
RQQLGIAQDDATDLQALFQQGYQGSRYSFGYPACPRLEDQRYLQDLLQWQEIGVELSEEF
QLHPEQSTSAIVVHHPSAKYFNL
Download sequence
Identical sequences D7BGK6
gi|297566358|ref|YP_003685330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]