SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297567288|ref|YP_003686260.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297567288|ref|YP_003686260.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 9.16e-57
Family Ribosomal protein S7 0.000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297567288|ref|YP_003686260.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Meiothermus silvanus DSM 9946]
Sequence
MSRRRQAEVRPLSPDLVYGDVVVSAFINRIMREGKKNLAARIFYDACKIIQEKSGQEPLK
VFRQAVDNVRPRVEVRSRRVGGANYQVPVEVSPRRQQTLALRWISNAAEGRPERGAAARL
AAELLEAAEGKGGAVKKKEDVERMAEANRAYAHYRW
Download sequence
Identical sequences D7BD19
gi|297567288|ref|YP_003686260.1| WP_013159285.1.93385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]