SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297567726|ref|YP_003686697.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297567726|ref|YP_003686697.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily AF1862-like 1.29e-28
Family Cas Cmr5-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297567726|ref|YP_003686697.1|
Sequence length 129
Comment protein of unknown function DUF324 [Meiothermus silvanus DSM 9946]
Sequence
MSQTRSQKDMQRALELVSSLERADPEVKRIYGGLCHSFPVMVLQSGLCQAVAFSADKASG
DGKRAQAHQHLLEHLGEMLGVRGKLLEALQSAPTPVYMHHTRRVLEAWVYFKRFAVSVLQ
VQAGEDHEK
Download sequence
Identical sequences D7BJ33
WP_013159703.1.93385 gi|297567726|ref|YP_003686697.1|NC_014213 gi|297567726|ref|YP_003686697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]