SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297564695|ref|YP_003683667.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564695|ref|YP_003683667.1|
Domain Number 1 Region: 759-914
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000125
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 2 Region: 47-75,126-251
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000121
Family BTAD-like 0.012
Further Details:      
 
Domain Number 3 Region: 914-1062
Classification Level Classification E-value
Superfamily TPR-like 0.00000000221
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 4 Region: 251-311,339-426
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000139
Family RecA protein-like (ATPase-domain) 0.093
Further Details:      
 
Weak hits

Sequence:  gi|297564695|ref|YP_003683667.1|
Domain Number - Region: 639-792
Classification Level Classification E-value
Superfamily TPR-like 0.000901
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297564695|ref|YP_003683667.1|
Sequence length 1163
Comment transcriptional activator domain-containing protein [Meiothermus silvanus DSM 9946]
Sequence
MSRLELRLLGPPELHLNGQKLVLPTRKLWAMVVYLAAQGRPVERGKLAGLLWDQADEERA
RGNLRQELYRLRGSPAEALLVVNPDTLALGGHASDLIETTRCLEQADWEGALACFRGEFA
AGLSVRGAPTFEDWLLLEREHWQGLWREAARKRAKELEAARPEEAQALLRCLLEADPFQE
DLQRALLALTARVEGAAAALGRYERYRALLQREFSLEPLPETLELVERLRRGQAPPPAPA
SEAPPSIPQALEHPPLVGREREWEQMEAAWQTGKALYLSGPPGVGKTRLMLEFARSKGQF
LLLEGRPSDSGIPYAFHTRALRQSLSLLGATELPSWVRQEVSRLVPELAEAPPPPITSEE
GKLRLLEAITEVIRQLARAGVGIVVADDLQFVTDAASLEVSAYAMARVLPERLSYPITAF
RGEELIPPIREAIFQQVERGLAVLIELKPLAPEGVGALVRVLSGSEARLFSRRLYNATGG
NPLFALETLKELFASGDLRVEEGIWSTPYDEATEDYRELPLPRSVQAAVNRRVDRLGGAV
RRLLEAASLAGEGFSLEELSGATALSDWEALEAAEVAVRAGLLQQKPDGLGFAHDLLRRA
LQEGLSLERRKVLHRKLAETLARLDGAPTRVARHLEQAGRPKEAVPWRLKAAEAAQAIYA
NREALNQYDKALADGAEGPTAFEVHAARAELYRLLDEQEGWQEELRALEESAYSLGDPVL
QARAALAGAKFERHTGRYGEALGRLEPLLQDPALPEVLRARAFFERGQTLLTLGRGDEAQ
KQLYQALRLEPSPLSPLAAEAHLILSDQAVGQGDLAAGQRHAREALAAFQAEGDRRGKGM
ALRNLGRAVGIGGDTARAIQILEQALQEAVAAGDVVSQRHILLNLFKFEFETGALEAALR
HLEQGRALLGNHPDPLQEGIFLNNLSVLQRMRGEFGLALETLQAALAVAERNGIAQGRAR
RRMSLVEYYLDLGRAEEALPLLGEAEALIEGAGLDELRAWLQAQYARREVLTAQPEAALA
RLEPLLAGPFADAHDGARAAWTAGLAWLALGEPGKALETVERLEVPPNPPFQARALAVRL
EASALLERDTPALIREAEALLAANTVPLLEALELYRAMSRAARPAQARKYRQAAAERCRK
IAAGLEGFPEFRVGFLRRYGPEG
Download sequence
Identical sequences D7BHC1
gi|297564695|ref|YP_003683667.1| WP_013156766.1.93385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]