SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297566561|ref|YP_003685533.1| from Meiothermus silvanus DSM 9946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297566561|ref|YP_003685533.1|
Domain Number 1 Region: 90-241
Classification Level Classification E-value
Superfamily TPR-like 2.1e-20
Family BTAD-like 0.033
Further Details:      
 
Domain Number 2 Region: 770-944
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000211
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 3 Region: 954-1082
Classification Level Classification E-value
Superfamily TPR-like 0.00000000474
Family BTAD-like 0.061
Further Details:      
 
Domain Number 4 Region: 248-296,368-515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000167
Family RecA protein-like (ATPase-domain) 0.059
Further Details:      
 
Weak hits

Sequence:  gi|297566561|ref|YP_003685533.1|
Domain Number - Region: 268-352
Classification Level Classification E-value
Superfamily PEP carboxykinase-like 0.00284
Family HPr kinase HprK C-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0374
Family PhoB-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297566561|ref|YP_003685533.1|
Sequence length 1139
Comment transcriptional activator domain-containing protein [Meiothermus silvanus DSM 9946]
Sequence
MKPYLSLLGPPTLTVRGKVTELPQRKAVALAAYLATRREPVERSVLAGLLWEGDEEAARR
NLRQELFRLKGSALEPLLEQTPQTLALGEVDTDLEAFLGHLARGEWAKAAGIWRGGFLPG
FEVRGGEAFLDWLLPEQERWQSLYREAMLGWARSREAAGAYQEALEIYQRMLEADPYQEQ
EQQAVMRLYALLGETPAALRQYEGYREVLRREFGVEPSLQTQALYRRLRQGKPLAEAEGW
LLPRGLSEPPLVGRAEDWMWLEANLRSGVLLLVTGEPGVGKSRLTQEFSRRRGRMLTVRQ
RESGRGLGFSGFIEAIRVALEQGWSPAGLDAAWRDQLTWLVPELLSKPEASFRRESREGL
LRGAGQVRYLKTRPLTSRSAKSHLFEALARFVQDWVGPGGILLWEDVHWADESSLEFLPY
LVQRSGGLGYMVLATARPEEQYPAQLRAVLQELKAEQAVKTHPLRNLEMAEVLELIRQLS
GQESGGSLFSERLYQSTGGNPFFLLETLRFLFEQGLLRVGEGSWHTPYDAFTADYRELPV
PPSVQGAVLSRFQRLTEEVAGTLSTREQALSVAQALALADQPLSLEALRDLLAEESPSDN
ALLAALDQLVQAGLVRAGSDSPGGVRFSLSHELSRQAILAAMPETTRMRFHARFAELLRI
SGAAPERLAPHLHLAGRPREAGQAYLQAARAARSGPLAAQALSYYAEARSLLGESLNPAD
SFALLAEIAELKLTLGENPRREVRQMNPLAAELGKAAQYRLRLLETNAAVLTGVVEEGIV
SARQALELAENPLERGQVLFRLAWLEYRGGDPDAQLEPLEQAIQAFHEAGERSLEAQAIR
NLSGYWLRLGQIEAFEAAYGEALRLAEATQDRYLLRRLMADRANVDWVMGRYGQSLAEGE
RLLAEARQTGDLWAVWDALQVQALNASVLGLDEGLEQALRDSLKEAEAAGAWRDRAVLRS
DLGAGLMAINRLAEAREHLSIALRELQELGERARLGHTLFALGWTLLDSGEPELAEAYLS
EAADLWRERKEWRHRARSLAALALARLRYGNRAKAREAAQEAMHYLEDWAKGLFDLPLVL
YAYARALGDREGRPYLVRSQKVMHELAATLEPALRERLLANRFVAHALSKSNNGGITGI
Download sequence
Identical sequences D7BHT5
gi|297566561|ref|YP_003685533.1| WP_013158574.1.93385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]