SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302669230|ref|YP_003832380.1| from Butyrivibrio proteoclasticus B316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302669230|ref|YP_003832380.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily CheY-like 1.22e-26
Family CheY-related 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302669230|ref|YP_003832380.1|
Sequence length 119
Comment response regulator domain-containing protein [Butyrivibrio proteoclasticus B316]
Sequence
MVDDDASFLKMVKDWLSDDYRVTIVSSGMQAITYIAKNRPDLILLDFEMPVTSGPQVLEM
IRSEVGTSNLPVFFLTGKGDKESVTKVLTLKPEGYILKSAGKTELVSQIKDYFERHKSV
Download sequence
Identical sequences E0S316
WP_013282448.1.55622 gi|302669230|ref|YP_003832380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]