SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375143681|ref|YP_005006122.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|375143681|ref|YP_005006122.1|
Domain Number - Region: 38-100
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 180-207
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375143681|ref|YP_005006122.1|
Sequence length 262
Comment PASTA domain-containing protein [Niastella koreensis GR20-10]
Sequence
MTGKPLWVHLLAALGLILLLIVVFLQSLHWITRHDKTLTIPAVTGKPYAEARKILESKGF
EVELQDSIYNDTAKPLSVLRQFPDAEAVVKVNRTVYLTINKSIAPLIEMPNLEGLSFRSA
EISLSQYLLKLGDTSYRMDFAKNSVLEQQFNGDRIKAGTKIPQGSKISLILGSGLGHEDF
SVPDLVGLTYNDAKVLLESNGLNVGTVIPSIDSSAFVGRQSPEHNTPDGRINRIRQGQSV
DLWLQRDKPVKATVPVVPPPQP
Download sequence
Identical sequences G8TPB2
WP_014216632.1.59341 WP_014216632.1.81374 gi|375143681|ref|YP_005006122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]