SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375148522|ref|YP_005010963.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375148522|ref|YP_005010963.1|
Domain Number 1 Region: 630-804
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.32e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1-188
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0018
Further Details:      
 
Domain Number 3 Region: 499-638
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.03e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.022
Further Details:      
 
Domain Number 4 Region: 146-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.39e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375148522|ref|YP_005010963.1|
Sequence length 833
Comment assimilatory nitrite reductase (NAD(P)H) large subunit [Niastella koreensis GR20-10]
Sequence
MKIVVIGNGMVGYKFCEKLTAKAQSGQIELVVFGEETRPAYDRVHLSEYFAGKTAEDLTM
AGLDWYAERNIKLYLGDPISYIDREQKTVRSHHGITESYDYLVLATGSAAFVPPIPGVEK
EGVFIYRTIEDLELMTAYAKKAKTGAVIGGGLLGLEAAKAMIDLGVTNTHVIEFAPRLMP
RQIDEAGSNILKAKLESLGLSIHTSKNTSEILGDQFINGMQFSDDTKLDVDMLVISAGIK
PRDELAKLAGLETGHRGGIVVNDKLTTADPFIFAIGECALHGGMIYGLVAPGYEMAEVVA
ANLMGGDKSFTGFDMSTKLKLIGVDVASFGDPFVAHTEGRSIVLEDSMKGVYKRINISND
GKYLLGGILVGDAEAYNMLLQTSKNKVVLPPNPEDVILGARGGSGGEGGAGITSLPDDAL
ICSCESVSKGDICKAVCDGNETMDAIKKCTKAGTGCGGCVPMVKDLINHTLKSQGKYVRN
VICEHFNYSRQELYDLVKVHKLMTFDEVLNKLGTGDGCELCKPPVASILASLWNEMILAK
GNDTAQDSNDRFLANIQKGGTYSVVPRIPGGEITPEKLIVIGEVAKKYNLYTKITGGQRI
DLFGAHVSDLPAIWSELIAAGFESGHAYGKALRTVKSCVGSTWCRFGLHDSVSFAIRIEE
RYRGLRAPHKLKSAVSGCIRECAEAQSKDFGIIATEKGWNLYVCGNGGSKPQHALLLATD
LDSETCIKYIDRFLMFYIKTADPLTRTATWLNKMEGGIDYLKNVVVNDSLGIAEQLEAEM
QLLVDNYKCEWKEAVENPEIRKRFSHFVNAPAEKDPSIQFEPMREQKKAKEWK
Download sequence
Identical sequences G8TEX2
WP_014221471.1.59341 WP_014221471.1.81374 gi|375148522|ref|YP_005010963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]