SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375150165|ref|YP_005012606.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375150165|ref|YP_005012606.1|
Domain Number 1 Region: 142-344
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000173
Further Details:      
 
Domain Number 2 Region: 430-557
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.33e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000628
Further Details:      
 
Domain Number 3 Region: 8-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.002
Further Details:      
 
Domain Number 4 Region: 346-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375150165|ref|YP_005012606.1|
Sequence length 562
Comment sulfite reductase (NADPH) beta subunit [Niastella koreensis GR20-10]
Sequence
MSTNDNKNLSSTEKIKMASDGLRGTLKESLRDEITGAIREDDTALVKFHGMYQQDDRDRR
EERSAKKLEWLYSYMLRLRLPGGFMTADQYIGLHNIAGDHSTGVIKVTTRQTIQLHGILK
SHVKPTIQAFNTILLDSISACGDVNRNVACAAHPKFSPIHEEIFSYAAKISKLGLPKSRG
YYEIWLDEKPLLDKKEKEAIEKDDLYQDRYLPRKFKVGIAIPPNNDVDVFTNDLGLIAII
ENDKLIGFNIAAGGGLGATHGNAATYPRLASMLGFVRGEANTLKAVLEVITIQRDHGNRS
DRKLSRLKYTIDKMGVEAFKEELEKRCGFKLEEPMPYTFTSRKDEYGWHKNHEGKWFYTV
FIENGRIADEKVAIKTALLEVAKTGKANFRFTSNQGLILSDIAQKDKKAVEKILTDFGII
AHTDSAGAVRKNAIACVAFNTCSLALAEAQRYLPSLITKIEPILAKYGLENDEISMRMTG
CPNGCGRPYAAEIGFIGTAYGRYNLHLGGDREGFRLNKKYKENIDEPAILKELDELFEKY
SKNRNSGETFGDFAVREKLVTI
Download sequence
Identical sequences G8TQF6
WP_014223114.1.59341 WP_014223114.1.81374 gi|375150165|ref|YP_005012606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]