SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375150494|ref|YP_005012935.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375150494|ref|YP_005012935.1|
Domain Number 1 Region: 246-585
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.00098
Further Details:      
 
Domain Number 2 Region: 50-244
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.75e-18
Family Penicillin binding protein dimerisation domain 0.0096
Further Details:      
 
Domain Number 3 Region: 654-706
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375150494|ref|YP_005012935.1|
Sequence length 707
Comment peptidoglycan glycosyltransferase [Niastella koreensis GR20-10]
Sequence
MEVKKDILWRVYVAFLGIVVFSLLILGRAVYIQQVQGPYWREQAKEQQQKFVEIDAQRGT
IYSEDGRMLSTSTPYFDIYIDFAAEGLRDKGGKRFEDNLDSLSIGLAAMFPEKNIASWRK
ELKTGYRKKNRYYLLKKNLTFQEYKQLRSLPLVREGKNKSGFIADVKDKRMNPFGLLANR
TIGLSREYMDSGGVMRSMNVGLEKTYDEQLRGESGKRLMRKIAAGVFAPVDGSEIEPQNG
RDIITTLDVNIQDITENALKNVLEANQCEYGTCVVMEVATGKIKAIANLSRREDGSYWEN
FNYAIQASEPGSTFKLATMLSLLEDQLVTLQQHIDLEGGSWNVNGRTVYDTEDHGTDATV
KHAFELSSNVGMAKLAMTYYGKNPTRFVNHIKKLRFDQQTGIDLMGESRPVVKTPKSKTW
SSTSLPWMSFGYEVLVSPLQTLMLYNAVANNGKMMKPYLVNAVMENGAKVKENQPEVLEE
AICSDKTLKLLKECLEGVCTDGTAAELLRGAPYKAAGKTGTALMANGPNGYADKIYQSSF
AGYFPANHPQYSCIVVIRNKPHAPVYYGAKIAGPVFKEIADKLYAQHADQGIRQLAIKKD
SSNYQYAGATEDIKEVMETLKMKYRDSAKADEWSKLAMVNEQPVLSKRTVANNIMPDMRG
MGLKDALFLLENRKLKVAFHGRGKVTSQSIEPGTYVNAHQTINLELN
Download sequence
Identical sequences G8TCS8
WP_014223443.1.59341 WP_014223443.1.81374 gi|375150494|ref|YP_005012935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]