SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375145029|ref|YP_005007470.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375145029|ref|YP_005007470.1|
Domain Number 1 Region: 410-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000143
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 2 Region: 205-303
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000895
Family Fibronectin type III 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|375145029|ref|YP_005007470.1|
Domain Number - Region: 622-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00073
Family Fibronectin type III 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375145029|ref|YP_005007470.1|
Sequence length 698
Comment fibronectin type III domain-containing protein [Niastella koreensis GR20-10]
Sequence
MRKMKQLSIILGVLLMPLWLLAQNPGKKLTSVRMIGRADSNRNAIYLRWASATPNSWKLN
NKYGFILVRYTVIRNKQMLPVPEKLVLSPTPLKPRALEEWENLAKKDNNAAVIAQALYGE
DFNVSINDKGAAKILAQSQELEQRFSFSLYAADNSFEGALMAGWAFVDKNVKADEKYLYR
LKPAAPAKLLAADSVSVFISPAEYEPLPAVQEVIARFGNKGVMLNWDIQMLSQYFASYYV
EKSDDGGVNFKKVNGLPVSNFDNGNGKQTRMFFMDSLKENGKEYQYRVVGVNPFGQPGPP
STIIKGMGRDMLAAVPNIRNAYVDKKGVLQVNWIFDEKGNNAIRGFLLKRADNIKGPYEK
FGDTLAVTSRTTALKKELGASNYFTITALAKEGEGSTSFPYLVQPEDSMPPAVPVNVKAV
IDTNGIVTITWDRNTEKDLMGYKIFRAQKKGEELVPLVDSIWYGTKFRDTLSLKMLNKRS
YYAVTALDTRFNQSAKSILVEVKKPEVIPPSPAVISKFKVEGTNVTLNWIASSDSDVVSH
AVYRKIPGDTSKPVVVRTFRGKDTTSYTDKGLTGGKSYIYYIVAKSEGGLTTPSEELTVI
TAQQANTEDAQFTRMYAYTQPEKRRIEITWDHNLQQVAELQVYKAEGGKQLVLWKVLPAA
EKGIYDTNVQANTEYQYGVMAVFSSGAFSSMKTVTTKY
Download sequence
Identical sequences G8T998
gi|375145029|ref|YP_005007470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]