SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375149898|ref|YP_005012339.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375149898|ref|YP_005012339.1|
Domain Number 1 Region: 115-202
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.68e-18
Family Middle domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000000000877
Family N-terminal domain of MutM-like DNA repair proteins 0.006
Further Details:      
 
Weak hits

Sequence:  gi|375149898|ref|YP_005012339.1|
Domain Number - Region: 209-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00191
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375149898|ref|YP_005012339.1|
Sequence length 274
Comment DNA glycosylase/AP lyase [Niastella koreensis GR20-10]
Sequence
MPEGPSIIILKEAVQQFKGRKILSASGNTHAIELDALVNQKIIGFKSWGKHFLICLPKFT
LRVHFMLWGSYSVNEPLKKNIRLHLHFNNGDLYLYSCSIKVIDEDLDQVYDWSGDVLNDA
WNESKARKKLKARPDLLVCDALLDQNIFAGVGNIIKNEVLFRIQVHPESIIKLLPPRKLT
ALIREARNYSFDFLEWKKAFVLRKHWLVHTKQICPRCVIPLIKKYLGKTGRRTFYCENCQ
ELYAERTTLSTERSRQKTKGENLTAKKKARKPTS
Download sequence
Identical sequences G8TJZ8
gi|375149898|ref|YP_005012339.1| WP_014222846.1.59341 WP_014222846.1.81374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]