SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296268105|ref|YP_003650737.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296268105|ref|YP_003650737.1|
Domain Number 1 Region: 19-350
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 5.75e-81
Family Nitrous oxide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296268105|ref|YP_003650737.1|
Sequence length 354
Comment 40-residue YVTN family beta-propeller repeat-containing protein [Thermobispora bispora DSM 43833]
Sequence
MLTRWFTTAAENRREISHVQVGVRRSRLRSVIMAAALATGLTGLASLPTTATAEEIRQPR
QVAYVTNNADNTVSAIDVASNTTIATIPVGAAPDGVAASPGGTRVFVANNADNTVSVINT
ATNGVIAIIPVGAGPTGVAVTPGGTRAYVANSGAGTVSVIDTATNGVIATIPVGTAPTDV
AVTPDGTRAYVTNNGSNTVSVINTATNTVIATIPVGVAPTGVGVSPGGTRVLVTNETDGT
VSVINTATNTVIATIPVGTTPSDVAFSPNGARAYVTNSGDGTVSVINTAGASLITTVTVG
TTPIGVAVSLGGTRAYVANSGDGTVSVIDTATNTVEATLTVGATPTEVAIANVP
Download sequence
Identical sequences D6Y2A9
WP_013130377.1.18579 gi|296268105|ref|YP_003650737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]