SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296268131|ref|YP_003650763.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296268131|ref|YP_003650763.1|
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000349
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 2 Region: 55-106
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000493
Family AraC type transcriptional activator 0.013
Further Details:      
 
Weak hits

Sequence:  gi|296268131|ref|YP_003650763.1|
Domain Number - Region: 126-201
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00942
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296268131|ref|YP_003650763.1|
Sequence length 315
Comment AraC family transcriptional regulator [Thermobispora bispora DSM 43833]
Sequence
MLERLNRAVDYIERHLDQRIDGAELARITLMSEYHFRRLFSALAGIPLSEYIRRRRLTLA
GAEVLAGKETLLDIAVRYGYGSGEAFARAFRALHGVGPAEARRTGAALFSQPRISFRLVV
EGSSGMRYRIVEKEGFRIVGKKARLPLVHEGMNPAIVAFVQSIDPETRRRIEELSDQEPR
GILNVSHDLAEGRAEGTEFDFYTAWSPALPRPRTWTCCPCRRGRGRSSRSRATSPWRSST
CGGTSSPSGSRRTPIRAGRARRCSAPGSHRTGRGRTRSCGSPWSGPRTDHGRPGAGSRDR
SECWGECFQFERSVR
Download sequence
Identical sequences D6Y2Q9
gi|296268131|ref|YP_003650763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]