SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296268470|ref|YP_003651102.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296268470|ref|YP_003651102.1|
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily DTD-like 8.11e-46
Family DTD-like 0.0000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296268470|ref|YP_003651102.1|
Sequence length 146
Comment D-tyrosyl-tRNA(Tyr) deacylase [Thermobispora bispora DSM 43833]
Sequence
MRAVVQRVTSASVTVDGKVVGAIDEPGLLVLVGVTHTDGRAEAARLAAKLWGLRILHGEK
SCSDLNAPLLVISQFTLYGDARRGRRPTWQAAAPAPVAEPLVDAVVEELRALGARVETGV
FGADMKVTLTNDGPVTLVLHVDAPSA
Download sequence
Identical sequences D6Y4F5
WP_013130742.1.18579 gi|296268470|ref|YP_003651102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]