SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296268616|ref|YP_003651248.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296268616|ref|YP_003651248.1|
Domain Number 1 Region: 185-437
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.72e-55
Family N-type ATP pyrophosphatases 0.00000326
Further Details:      
 
Domain Number 2 Region: 6-190
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.04e-54
Family Class I glutamine amidotransferases (GAT) 0.0000198
Further Details:      
 
Domain Number 3 Region: 396-517
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 8.63e-48
Family GMP synthetase C-terminal dimerisation domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296268616|ref|YP_003651248.1|
Sequence length 517
Comment GMP synthase large subunit [Thermobispora bispora DSM 43833]
Sequence
MSEFDTVLVVDFGAQYAQLIARRVRECHVYSEIVPSTMPVSEMLAKKPKAIILSGGPASV
YAEGAPSVPEGLFETGVPTLGICYGFQAMAQALGGRVARTGVAEYGGTELKVLHEGVLFA
GLPAVQSVWMSHGDSVVEPPPGFTISAATEATPVAAMEDPRRGLYGVQFHPEVIHSEHGK
AVLKHFLDAAGCRPTWTMLNIVEDAVEAVREQIGDGRAICGLSGGVDSAVAAAIVHRAIG
DRLTCVFVDHGLLRKGEAEQVERDFVAATGVKLRVVDASDRFLKALAGVRDPEEKRKIIG
REFIRVFEDEARAIRATAGGPVDFLVQGTLYPDVVESGHGTGTANIKSHHNVGGLPEDLK
FTLVEPLRTLFKDEVRRAGEELGLPPAIVWRQPFPGPGLAIRIVGEVTRERLDLLREADA
IAREELSRAGLDRDIWQCPVVLLADVRSVGVQGDGRTYGHPVVLRPVTSEDAMTADWARV
PYDVLSRISTRITNELPEINRVVLDVTSKPPGTIEWE
Download sequence
Identical sequences D6Y5K9
WP_013130888.1.18579 gi|296268616|ref|YP_003651248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]