SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296269051|ref|YP_003651683.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296269051|ref|YP_003651683.1|
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-46
Family Ribonuclease PH domain 1-like 0.000000195
Further Details:      
 
Domain Number 2 Region: 320-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-43
Family Ribonuclease PH domain 1-like 0.000000693
Further Details:      
 
Domain Number 3 Region: 151-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-29
Family Ribonuclease PH domain 2-like 0.00000635
Further Details:      
 
Domain Number 4 Region: 473-567
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.87e-25
Family Ribonuclease PH domain 2-like 0.000024
Further Details:      
 
Domain Number 5 Region: 572-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.23e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 263-343
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.11e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000403
Further Details:      
 
Domain Number 7 Region: 644-728
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000209
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296269051|ref|YP_003651683.1|
Sequence length 773
Comment guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [Thermobispora bispora DSM 43833]
Sequence
MEGVHTSEAVIDNGSFGTRTVRFETGRLARQATGSAVAYLDDETMVLSATTVSKQPKEGL
DFFPLTVDVEERMYAAGKIPGSFFRREGRPSEDAILTCRLIDRPLRPSFAKGLRNEVQIV
ATVLAIHPDHLYDVVAINAASMSTQLAGLPFSGPIGGVRVGLIDGKWVAFPTYSELENAT
FDMVVAGRVLEDGDVAIMMVEAESTRNTLKLVAEGAVAPTEEVVAQGLEAAKPFIKVLCE
AQEKLAKVAGKAPGNYPIYPDYQDDVYEAVCAAVKSELAAALTIPGKQERELEIERVKAI
AAEKLLPEFEGREKEIGPAFRALTRQLMRERVLNEGIRIDGRGPKDIRQLNAEVHVIPRV
HGSALFERGETQILGITTLNMLRMEQTIDTLNPERTKRYMHNYNFPPYSTGEVGRVGAPK
RREIGHGALAERALLPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTMSLLDAGVPL
KDMVAGIAMGLIGENGKYVTLTDIIGAEDAMGDMDFKVAGTRDLITALQLDTKLDGIPAE
VLAGALKQARSARLAILDVMKEAIDAPAPLNPNAPRILTLKVPVDKIGDVIGPKGKIINQ
IQEKTGAEITIEDDGTIYIGATDGASAEAASALINGIANPHMPEVGERYLGTIVKLAAFG
AFVSLLPGKDGLLHISQIRKLYGGKRIDNVEDVLTVGEKIQVEVVEIDSRGKLSLVPVEV
IERERAEKEKAEKEKAEKEKAAAAATASADEDEQPRRPRRRRTRAGRTTQRNT
Download sequence
Identical sequences D6Y7X1
gi|296269051|ref|YP_003651683.1| WP_013131323.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]