SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296269806|ref|YP_003652438.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296269806|ref|YP_003652438.1|
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.58e-27
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|296269806|ref|YP_003652438.1|
Domain Number - Region: 125-288
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0628
Family Cgl1923-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296269806|ref|YP_003652438.1|
Sequence length 376
Comment oxidoreductase domain-containing protein [Thermobispora bispora DSM 43833]
Sequence
MLVETVRIGVAGLGAIAQVAYLPLLDRRRDLFRLAAVCDLDREHAEWFGHRFGVPAYDDP
ERMLDAGGCDALLVLTSGSHGALVRAALERGLWVLSEVPLGYSRAELSDLPDAARLMVGY
MKQYDPAAQRLLECLHEAGGPEVIRHLCVTVLRPPGRTQLLFAKPRGSHPSPARLSRYAD
ADERSISAALGEEAPKPVRRLYAEVLLEGVCLELSLIRMFTGAPASVDHVAVWPAETYPP
SVEASGALPGAGRYGLHWHFLTGYPAYHQTVALHHEHGSFELSFRCPYLLNTPSRLLIRS
RIGTTERTLVFEDVAEAFERQLVAFHRFVTQDERPVSGLAEALTDIAVAQRMIRRYAEAA
GEPVGGECAALPAGGG
Download sequence
Identical sequences D6YBI5
gi|296269806|ref|YP_003652438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]