SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296269828|ref|YP_003652460.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296269828|ref|YP_003652460.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 1.2e-87
Family Cgl1923-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296269828|ref|YP_003652460.1|
Sequence length 284
Comment hypothetical protein Tbis_1855 [Thermobispora bispora DSM 43833]
Sequence
MIEIEGLPELVDPVMIAAFEGWNDAAEAATGVITHLEAEWKATPLVELDPEDYYDFQVTR
PFVEIGEGRQRNIVWPTTRLLLARPPEAGRDVVLLRGIEPNMRWRSFCAEIIGLCQDLGV
EQAILLGALLNDSPHTRPVSVMATASDPGIARSYNLELTTYEGPTGIVGVLHGALSAAGL
QTVSLWASVPHYVAQPPNPKATLALLRRIEDLLDIPMPYGDLSEEARAWEHGVDELAAQD
SEVAEYVRELEERKDAAGLPEASGEAIAAEFERYLRRRERGTDR
Download sequence
Identical sequences D6YBK7
WP_013132100.1.18579 gi|296269828|ref|YP_003652460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]