SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296269999|ref|YP_003652631.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296269999|ref|YP_003652631.1|
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 1.44e-19
Family C-terminal domain of arginine repressor 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296269999|ref|YP_003652631.1|
Sequence length 185
Comment arginine repressor ArgR [Thermobispora bispora DSM 43833]
Sequence
MTIPLTKAARQARIVELLTRHKVRSQAELARLLAEQGVEVTQATLSRDLDELGALRLRAD
DGTLVYALPGEGGGRIPLYRTGSGTAENPDARLRRIAEELLVSAEASANLVILRTPPGAA
QFLASAIDHADWESILGTVAGDDTILVISRDPQGGEALAKALLDLTNRRPGDAVRNRAIG
EENNG
Download sequence
Identical sequences D6Y1Y2
gi|296269999|ref|YP_003652631.1| WP_013132271.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]