SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296271197|ref|YP_003653829.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296271197|ref|YP_003653829.1|
Domain Number 1 Region: 39-90,247-486
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.39e-69
Family Bacterial dinuclear zinc exopeptidases 0.00000734
Further Details:      
 
Domain Number 2 Region: 132-242
Classification Level Classification E-value
Superfamily PA domain 0.000000000000785
Family PA domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296271197|ref|YP_003653829.1|
Sequence length 518
Comment aminopeptidase Y [Thermobispora bispora DSM 43833]
Sequence
MRITVGRGVGGAIAALALVLPLATAGPAHADPDPEALIRAIATAGVKQHLKKFQEIAQAN
GGTRAAGTPGYDASRDYVVSRLKKAGYKVTVQPFDFPFFQEKSTAVLERISPSPKTYNPT
PPDGSGIGDFATMTYSGAGDVTAAVQAVDVQIPPASEPNSSTSGCEPSDFASFTPGSIAL
LQRGTCTFQEKAENAQAAGAAGVIIFNEGQEGRTETIQGTLGEPTVRIPVVGASYEVGQE
LAAAGTTVRLKTDTISETRTTHNVIADSKWGDPNKVVQLGAHLDSVLAGPGINDNGSGSA
AILEVAEVLGKIPTRNKLRFSFWSAEELGLLGAEHYVASLSPAELAKIKLYLNFDMIGSP
NYAIMIYDGDDSDGVGAPAGPPGSDEIEKLFEKYFKALRQPYQGTDFDGRSDYGPFIEAG
VPSGGLFTGAEGIKTPEEQKKYGGTAGIAYDPCYHQACDDLSNINDKALALNTGAIATAA
VVYAFSRDLPGPDTRPAMSAARTASVQADAHHGHGIIR
Download sequence
Identical sequences D6Y8X4
gi|296271197|ref|YP_003653829.1| WP_013133469.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]