SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300113115|ref|YP_003759690.1| from Nitrosococcus watsonii C-113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300113115|ref|YP_003759690.1|
Domain Number 1 Region: 113-312
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 6.28e-52
Family Thiamin phosphate synthase 0.00039
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily Nudix 8.94e-38
Family MutT-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300113115|ref|YP_003759690.1|
Sequence length 317
Comment mutator MutT protein [Nitrosococcus watsonii C-113]
Sequence
MVLQVAAGAIFNREGQVLLSKRPPHVHQGNLWEFPGGKLQPGEEIRQALSRELWEELGIQ
VLQARPLLQVRHDYPDRSVLLHVWRVERFSGMPKGQEGQPVVWVQPENLSAYPLPAANSP
IVTAVCLPPTYLITKEPAGNQIVFLSSLRRSLQAGVRLVQLRAKKLSSEHYQDLTWKVQR
LCFEYKAILLVNTVPAQAAEWGADGVHLTGNHLMHLSQRPLPADKWVAASCHNAEQLAHA
ASIGVDFAVLGPVCHTSTHPQALPLGWERFQTLIAQIPFPVYALGGLGPEHVKEAWSRGA
QGIAAIRGLWGDRGSRD
Download sequence
Identical sequences D8KA54
gi|300113115|ref|YP_003759690.1| WP_013219479.1.90395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]