SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300113436|ref|YP_003760011.1| from Nitrosococcus watsonii C-113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300113436|ref|YP_003760011.1|
Domain Number 1 Region: 19-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.25e-32
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300113436|ref|YP_003760011.1|
Sequence length 259
Comment AcfC-like protein [Nitrosococcus watsonii C-113]
Sequence
MKFLSLIVMWALAFSAHGVDLYVYGPGGPAPAMKAAAAAFEKASGTKVVVTAGPTPTWIE
AARGNADLLYSGSEHMMSDFLVMLGSMLAADTVRPMYLRPAAILVRPGNPAGIGGLVDLL
KPGHRILVVHGAGQVGLWEDIVGRDGDITTLRALRSNIVHYATNTGAAKERWLTDPKIDA
WIVYNIWAIANPGIADVVPLEPHYRIYRDCGIVLTERSRAKPEAQAFTRFLESDQGRAIF
ERFGWVRRDAEAAAAKEGF
Download sequence
Identical sequences D8KBS9
WP_013219795.1.90395 gi|300113436|ref|YP_003760011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]