SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300113919|ref|YP_003760494.1| from Nitrosococcus watsonii C-113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300113919|ref|YP_003760494.1|
Domain Number 1 Region: 416-535
Classification Level Classification E-value
Superfamily PR-1-like 1.44e-22
Family PR-1-like 0.0035
Further Details:      
 
Domain Number 2 Region: 313-399
Classification Level Classification E-value
Superfamily PKD domain 1.96e-19
Family PKD domain 0.0068
Further Details:      
 
Domain Number 3 Region: 62-262
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000144
Family Integrin alpha N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300113919|ref|YP_003760494.1|
Sequence length 541
Comment hypothetical protein Nwat_1243 [Nitrosococcus watsonii C-113]
Sequence
MYLHRKMLCFAFLISTLCSLSTVAFAIEEKLAIIKNNANGQGLTLQVYTPPLAPKNRLEA
KLFQDVQIFGNVASLAAGNINGTTGDEFIFLTDGSFGSNGLYLYTVKPEDGALSFHLLAD
DRSLERNVQFATLCDCDSDPEKELAIIKRLQNGSHQLIIYDLPTRRWGNALAIAGAANIG
NNIIGLSAGDMAGNSKSELVIAQKNGNGTVRVEIYSPPSSLSDSLGPPLLSYSDLGSDII
PDGLAVGDFDHDSEDEIALVRSLKNGAHGLDILKAPTAFGDEDPVFIASNVNIGQNVAKM
TAFKINTAGPSFNQPPQAVVNANPRKGSLPLTVTLDGSNSQDADGFIQHYLWEFDNGQII
TGPKLQYTYDTPGAHVVTLTVIDNENSQDSTQITIEATEAANNNDTTDSQNLLPAERELI
KLINQERQKYNLASLKVHSALVTAAKEHSKDMAQNNFISHTGSDGSSPFTRMADAGYRFR
TAGENVAAGYSSPQAVLAGWMNSPGHRRNLLNANYCELGVGYAYQGRSTYGRYWTLTLGC
R
Download sequence
Identical sequences D8K5J6
gi|300113919|ref|YP_003760494.1| WP_013220269.1.90395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]