SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297558997|ref|YP_003677971.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297558997|ref|YP_003677971.1|
Domain Number 1 Region: 18-172
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.65e-16
Family Prokaryotic proteases 0.065
Further Details:      
 
Domain Number 2 Region: 647-837
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000342
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297558997|ref|YP_003677971.1|
Sequence length 851
Comment peptidase S1 and S6 chymotrypsin/Hap [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MDPRCVADVRVARAGAASRGGTGYLVGPSLVLTAAHVLDGHERVDVRLGADRPSGFLRCS
VVWSDRSTDVALLRLEEPRPHPSVRWGKLSADEPQPYRSLGYPDLAANDGGRDLKDLRGT
LSPWDGMVRKDLRLDVQREYGNDVSWKGASGTAVFVRERLVGVIVDHDRRNGDLIARRST
RFARDKDFRRLVREDAGTEPWLVPVDLPRAARNTARRFVRARLSSLRRLPHTLAVAVRER
RGHGTRAGTAAVPARRSRATAGMRERRGAGRPVWPLAVAAVALLTLVPNGVYWLRANGHL
GLGLQCAPPTELTVLTTPDQHAVVQRAADDFSAHVGGRDERSGCVPVRVSVTVAGGAART
RELLREGWTDLRAGPRPHVWLPDSSADVALLRGDPGDAPGLETGEGSATRLTPVVLGLPE
SAGEVPACSGTDPGGARSNLVVCTAAAAEAGLLLARPSPEASVSALIQTEALYSAYGDGG
AEEIQIAEARATSAGLDAEGNLGLLCALRGGSADPASVGVFSTEYAINAYNTGAQLGPGC
GPTGEEPDEPLVPVYFSETPGLDHPFVRLDWGGDGVEREAEAFGEWMRHPRETTAFQGYR
TVEGAMIGGDAERSLMEVTHLNSARQDGEWRERLESGLRQQERSRAPVEVLLVVDRSDSM
SGPGTGGTRLATAQQLARTAVGLLGEQDTVGIWTFPEGGPGNDVTGQERVLPPEPGMDAR
REESAREAIDALSAEFPATPLADAVRDGAEELESCADRPGEPGACALVVLTDGVALPEPR
GGARADDVAAVLEDLDERVRVHVVSVGDEGCGGDGLLSRLAGAGAECHHPRADELEQVVY
GIVAGTRAATP
Download sequence
Identical sequences D7B612
WP_013151072.1.70090 gi|297558997|ref|YP_003677971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]