SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559020|ref|YP_003677994.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559020|ref|YP_003677994.1|
Domain Number 1 Region: 23-258
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.42e-31
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 
Domain Number 2 Region: 576-626
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000000523
Family Carbohydrate binding domain 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|297559020|ref|YP_003677994.1|
Domain Number - Region: 457-517
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00406
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 323-385
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0114
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297559020|ref|YP_003677994.1|
Sequence length 626
Comment serine/threonine protein kinase with PASTA sensor(s) [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRGNRIRAMETPTPDPLFGITLHERYILGKRLRSGASGTVHVAHDLGGDQTVTVTVLHPW
LVGDHGAVHAFLDRAQTLEGLSHPGIARVLGHGRDGEHVYAVGEYLSGHTLAEALGEGGG
GLRYPVQAALAIVAGALTALDAAHGAGVVHGALDPHTVVVDGEGGVRVTGFPLLFDAEED
AGPETRTDVHAVGRLLYTLLTGVPADPEARPLRPSAVIPGLPSDLDMLVANATDPNPRYR
PRDAGQYLTVVEQVLRSLSGAPVNPADVDTRPIPVITDAPPERGEERAAPVPPWRRVPVL
VTAGVLVLVLFAAGWALVPDDRVALPDLVGASSEQAEERLAGLGMDLAVRFEDAYSDTVG
AGAVADSTPAPGSDVARGAEVLLHVSTGPRYSGVPDVVGGTENEARETLRQAGFTGIEIV
QEHSPDQPPGTVLSTEPAAGEEGDREEPVVLSVSEGVIVPTLIGMGQEEAATALAGLGLV
VQVTEEHHDTAPVGEVSGQTPEPGTILPEEAAVSLTVSLGPEPEEEEEESEEEASPSDED
DPRVDEGEQDGRGDQDGWGGRGDDDDDRGRGDGGGSCDAPQWNGGTVYDTGDRVQHDGRE
YEARWWIQGYPPSGDQWGVWEDKGSC
Download sequence
Identical sequences D7B6T4
gi|297559020|ref|YP_003677994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]