SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559132|ref|YP_003678106.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559132|ref|YP_003678106.1|
Domain Number 1 Region: 12-220
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-38
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559132|ref|YP_003678106.1|
Sequence length 315
Comment ion transporter [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRRAQVTRLVESQWFSNIVLAVILVNAVILGWMTYGGSALPYLVVIEYVVIGVFVVEMIL
KIHAWRGRFFRSAWNWFDFLVVLVSVIPATGPFAVLRILRVLRILRVITAVPQMRQIITA
LFKAMPGVGTVIGLLLVVIYTSAIIAHQLFGEAVPVFFGNLGTSLYTMFLLMTTEGWPDV
SDAVLAEHPTAWIFFVCYIVLTAFIMLNLVIAVIVTSLEQEISEVRWAEDQQLEEVQHEA
VMARLVELGQQVERLDRMLRERDADPGAAGLPGSVQADRATQTAQAVRTIQPGEPAESVR
RGNGDAAQPPPPSPL
Download sequence
Identical sequences D7B746
WP_013151207.1.70090 WP_013151207.1.87825 gi|297559132|ref|YP_003678106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]