SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559199|ref|YP_003678173.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559199|ref|YP_003678173.1|
Domain Number 1 Region: 145-345,488-596
Classification Level Classification E-value
Superfamily Subtilisin-like 1.22e-70
Family Subtilases 0.0000525
Further Details:      
 
Domain Number 2 Region: 351-468
Classification Level Classification E-value
Superfamily PA domain 0.000000000000353
Family PA domain 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|297559199|ref|YP_003678173.1|
Domain Number - Region: 615-683
Classification Level Classification E-value
Superfamily Cupredoxins 0.0156
Family Plastocyanin/azurin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297559199|ref|YP_003678173.1|
Sequence length 883
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MVPHRTRLASLAGLTLVAGLVAAAPASADDASELAPLHPAPSAENGELTHQADGLWFIEL
ESPPTTAGTSSAQVENEHEAFRAEAEESGLEYTERHSFGDLWNGFSVEMDDAQVGTAREI
PGVSAIYPVVTYEVPEGDTSVPDLDTALPMTGSDIAQNELGLTGEGLRVAVMDTGVDYTH
PDLGGGGFPNDRVVTGYDFVGDDFNAGDPTTVPAPDDDPQDCHGHGTHVAGIVGARGEVT
GVAPGVDFGAYKVFGCEGSTTSDIMIAAMERALADDMDVLNMSIGSAHSWPQYPTAVASD
NLVDEGMVVVASIGNEGDTGLYSAGAPGLGEDVIGVASYDNTHIRSASATANPSGETLAY
MEMGEASPPPASGETDELVHVGRGCPSLGDELEADPEGRTALMVRGACTFAEKYDAAVAA
GATGVVMYNNVPGMFAGGGIVDQGAFSIGISDTSGAHLLELLEGDEPVTLSWTGESTTIP
NPTGGLISSFSSFGLSPDLALKPDIGAPGGLINSTYPMAKGGYATISGTSMSSPHVAGGV
ALLLEARPDLGAHEVRDVLQNSADPKAWWGDPDAGYTDNVHRQGAGMMDVPGAVLATTAV
TPGKLSLGATEGEVTETITIANDGDEEATYTLDHESALGTHGNTFTPGYNDASAEVAFDR
DEVTVAPGGTAEVQVTFTPPAQDFQQMIYGGYVSVAETGGETYRVPYAAYNGDYQQIEAM
TPITDGSGNVLELPWLTRITECGAFSGLECVGEGGGTFENQPEGAAYTLEWVDGLPDVPY
VIAHFDHHVTLLEMTVVDERTGRPVHPDRNVGVSVDHVNRSATGTSFFSYAWDGTVLDRH
DRITPVRDGQYRLEARALKALGDPDNPDHWETWTSPVITIDRG
Download sequence
Identical sequences D7AUA9
WP_013151274.1.70090 WP_013151274.1.87825 gi|297559199|ref|YP_003678173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]