SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559213|ref|YP_003678187.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559213|ref|YP_003678187.1|
Domain Number 1 Region: 14-109
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.9e-21
Family Hjc-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559213|ref|YP_003678187.1|
Sequence length 121
Comment hypothetical protein Ndas_0231 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MDRWAEYRRTLGGRGEDLAAAFLRRAGMRVVARNWRIPDGEIDIVARDGPVLVVAEVKTR
TSVRHGHPVEAITPDKRRRLRRLGHAWAVRHRVPAHPLRVDGVCVLISGGRVFVSHERGM
A
Download sequence
Identical sequences A0A223Q8J2 D7AUC3
WP_013151288.1.62139 WP_013151288.1.70090 WP_013151288.1.87825 gi|297559213|ref|YP_003678187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]