SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297559317|ref|YP_003678291.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559317|ref|YP_003678291.1|
Domain Number 1 Region: 5-89
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 7.19e-18
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297559317|ref|YP_003678291.1|
Sequence length 129
Comment ATP synthase F1 subunit epsilon [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSKKLFVEIVSPEREIWAGEGDMVIAKTVEGEMGVQPGHVPVLSLLAHDAVVRVLGARET
GEVRAAAHGGFVSVSGEGRVSILAETAELAEDIDVDRARTALKGAAESGDNVALGRARSR
LRAAGEEVA
Download sequence
Identical sequences A0A223Q8I2 D7AVC4
WP_013151392.1.62139 WP_013151392.1.70090 WP_013151392.1.87825 gi|297559317|ref|YP_003678291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]