SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559324|ref|YP_003678298.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559324|ref|YP_003678298.1|
Domain Number 1 Region: 80-132,270-509
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.34e-62
Family Bacterial dinuclear zinc exopeptidases 0.0000289
Further Details:      
 
Domain Number 2 Region: 152-240
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000235
Family PA domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297559324|ref|YP_003678298.1|
Sequence length 534
Comment aminopeptidase Y [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRTSSEGKPPRGAAAPASRRRAATAGAAAVLMAVAALASSPAHAEPGPPGHAGPPDHSGA
PGHAGPPAHAGRPGEDPPLSERVSAEAIREHLENLDTIAEYNGGNRATNTPGYDVAALYI
EDQLERAGYEPYRHEYEYELWRENSPAVLAQTAPEQVAYEAETDYATMSYSGSGDVTAPA
VAVNADSAASGCSPDDFADFPEGAVAITVRGTCPFSDKVDNAAAAGAAAALVVNNEDEVF
LGTVGEHSAIPALGVSGTLGAELLAAEGLELRVSVDAEVSNETSYSVLAETPGGRDDNVV
VVGGHLDSVEDGPGINDNGSGAAFLLETAIQLAEQEEPDNKVRFAFWGTEEEGLVGSTRY
VEDLTAQEVEDIALYLNFDMIGSHNYGRFVLDGRMELPGSVAAPSGSGAIAKVFEDYFAA
QDQVSEPGVLSGRSDYQAFMTAGIPSGGLFSGADGVKTEEQVEWYGGTAGEQFDPYYHTA
DDTMEHINWDSVAELSAAGAHGVEFFAESTLPVNGVLRTTAAPDFPRLGDGWLR
Download sequence
Identical sequences D7AVD1
gi|297559324|ref|YP_003678298.1| WP_013151399.1.70090 WP_013151399.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]