SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559341|ref|YP_003678315.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559341|ref|YP_003678315.1|
Domain Number 1 Region: 147-443,513-548
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.28e-86
Family Type II chitinase 0.000000211
Further Details:      
 
Domain Number 2 Region: 36-141
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.81e-29
Family Cellulose-binding domain family II 0.00027
Further Details:      
 
Domain Number 3 Region: 445-515
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000633
Family Chitinase insertion domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297559341|ref|YP_003678315.1|
Sequence length 559
Comment glycoside hydrolase family protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRARRFSTRLAAAAAAVLLAPLAVTAVPAAAAEETGPADLTVTYTESARWNTGYTGQITV
HNASDTPVEDWAVEFSLPDGSRIHELWNATLAGTPGGYTITPPHWGASVPAGGSYSFGFN
GLHSDGATDLVDCLVNGSPCAGDDGSGPSHDSYSVAYYTQWSAGERDYHVRDLVDSDSAE
KLTHINYAFGNVTAEGVCATGDGTSQEGAVADYAHPVPAAESVDGTADDPDQELRGNFNQ
LRELKEMYPDLKVNISLGGWEWSRYFSDAALTEESRERLVSSCVDLYLRGNLPEVDGAGG
EGAAYGVFDGIDLDWEWPGSDGHPHNTVRPEDKENFTALVQEFRDQLDAFGEETDRHYEL
TAFMPAGGWRLDAGYELDELMTDFDFVTVQGYDYHGTWESTTNHQSNLVVDARDPQPVIS
TELIVQAYLDRGVDPGKLVLGVPFYGQGWTGVEPGPDGDGLFQTATGPAQGAYAAGTEDW
KVLEEKVESGEFEVFRNDGAGTAWIYDGQTLWNYDDETAMTQKTDWARDKGLGGVMIWSI
DGDDAEGSLMAAIDTALSD
Download sequence
Identical sequences D7AVE8
gi|297559341|ref|YP_003678315.1| WP_013151416.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]