SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297559404|ref|YP_003678378.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559404|ref|YP_003678378.1|
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Single hybrid motif 5.89e-40
Family Biotinyl/lipoyl-carrier proteins and domains 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297559404|ref|YP_003678378.1|
Sequence length 126
Comment glycine cleavage system protein H [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSVPTELGYTAKHEWVVVEDGIATVGITSFAAESLGDIVYVEVPEVGSEVTADEPCGEVE
STKSVSDVYSPVSGEVTEVNAILENEPETINSSPFEDGWLFRARISEEPTDLLSAEEYTK
LTEGEE
Download sequence
Identical sequences D7AWA6
gi|297559404|ref|YP_003678378.1| WP_013151479.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]