SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559703|ref|YP_003678677.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559703|ref|YP_003678677.1|
Domain Number 1 Region: 26-336
Classification Level Classification E-value
Superfamily Aldolase 1.61e-95
Family HMGL-like 0.00000000268
Further Details:      
 
Domain Number 2 Region: 464-565
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 3.66e-34
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 404-453
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000349
Family DmpG/LeuA communication domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559703|ref|YP_003678677.1|
Sequence length 566
Comment 2-isopropylmalate synthase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MVPQQKPSPMPFHRYKPFAPVDLPDRTWPSKSITEAPRWLSTDLRDGNQALIEPMDPARK
REMFELLVRMGYKEIEVGFPAASQTDFDFVRSLIEGDAIPDDVQISVLTQAREDLIERTV
QSLVGAKRATVHLYNATAPTFRRVVFRVDREACKDIAVQGTRHVMRFAEQYLGETEYFGY
EYSPEIFIDTELDFALEVCEAVMDVWQPGPGREIILNLPATVERSTPNVYADQIEWMSRS
LSRREHVVVSVHPHNDRGTGVASAELAVMAGADRVEGCLFGHGERTGNVCLVTLGMNLFS
QGVDPRIDFSDIDEIRRTVEHCTQLPVAPRHPYGGDLVYTAFSGSHQDAIKKGFAAQQEA
ADAAGTPVEEHVWDVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVSYIMQRDHSLDLPRRL
QIEFSQVIQKFTDAEGGEFAAGRIWEIFSQTYLAEGGPVAVLAHRSTTDSDGTYRIEADA
RVNGEIRELTGTGNGPISAFCDALTDVDVKVRVMDYVEHSMGGDGDARAAAYVEAEIDGR
VVWGVGIHSSITTASLKALCSAIARV
Download sequence
Identical sequences D7AYI6
gi|297559703|ref|YP_003678677.1| WP_013151778.1.70090 WP_013151778.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]