SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559728|ref|YP_003678702.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559728|ref|YP_003678702.1|
Domain Number 1 Region: 18-334
Classification Level Classification E-value
Superfamily FucI/AraA N-terminal and middle domains 1.09e-66
Family AraA N-terminal and middle domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 332-478
Classification Level Classification E-value
Superfamily FucI/AraA C-terminal domain-like 1.73e-39
Family AraA C-terminal domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559728|ref|YP_003678702.1|
Sequence length 478
Comment L-arabinose isomerase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTVPTPPATEHPPVRARAPRVGLLGIMQPLYDDMIPGITEHQAAYAARVAERLSGVAEWT
VAPPVRGRADAEEAIRGFEAAGLDGVLVVMLTYGPSLRVTRALARTHLPLALANIQPDPA
VSPSWDMDDMTYNQGIHGAQDTANAMVRAGLPFEVLTGEWQSPEFAARVDRWARAARAVT
ALRGLRVGVFGYPMNGMGDARVDETALLRRLGPEVHVIAPGALHRTMADLPEQAVRDLMA
WEDGALEVDGRLSEEEREDHARMQLGIERLLEESGCGAYSTHFDAIGEDGRFARLPMAAA
STLMAQGYGFAGEGDVLAASIVYAGHQLAGDGHFTEMYAMDFPSDSILMSHMGEGNWRVA
REDEPIRLVKRPLGIGGLGDPPTIVFRYRPGPATLASLVALGGEEFRLVVAEGEVIDAPE
LPSLEMPYGQFRPETGVRACMDAWLRAGGTHHMVMNTGARAQDWRVLCELSGIEYVRV
Download sequence
Identical sequences D7AYL1
WP_013151803.1.70090 WP_013151803.1.87825 gi|297559728|ref|YP_003678702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]