SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559740|ref|YP_003678714.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559740|ref|YP_003678714.1|
Domain Number 1 Region: 43-330,394-436
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.44e-76
Family Type II chitinase 0.000000339
Further Details:      
 
Domain Number 2 Region: 332-395
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000662
Family Chitinase insertion domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559740|ref|YP_003678714.1|
Sequence length 439
Comment chitinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRTTPAPPDGAPPPRRRPLLVLGAVVAAAVLITGVFVAATGRNPERLGYFADWNVANRGY
TVKELEDSGAPEHLTRLMWAFGDISSGGLCRIPGTHDQPWELYQRRYDADESVSGRADEY
EQELAGSLNQLRQLQERHPHLRASLSLGGWNWSTHFSTAARTPESREAFVASCLDLWLRG
DLPVFEDEPQGGDGAAAGIFDGIDLDWEWPGGAGHPDNVEHPDDATNFTLLAAEFRRQMD
ALSRETGEEYVLSASLPGGAAASQAYDARVFEYLDFATVQGYDFAGPWSERTAYHSNLYT
SDADANSVDRAVRRYVDLGAPPERLVMGVPAFGRGWRLEDPSEPGPGQPVAGPAEDRYDG
PTMAFSELQEIEGPRALDEEAGASWVLDGDEWWAYDNPEVIRLKGEYVLERGLGGLMVWN
LDMDPRGELVRAMDESLGG
Download sequence
Identical sequences D7AZB6
gi|297559740|ref|YP_003678714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]