SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559888|ref|YP_003678862.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559888|ref|YP_003678862.1|
Domain Number 1 Region: 78-306
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.08e-66
Family Pseudouridine synthase RsuA/RluD 0.0000128
Further Details:      
 
Domain Number 2 Region: 12-105
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000209
Family Ribosomal protein S4 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297559888|ref|YP_003678862.1|
Sequence length 308
Comment pseudouridine synthase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSDVRSLPVPDGLEGDRLDSAIARMFGLSRTRAAEIIGDGGVLVDGSEAAKSDRVSAGAW
LEVTLPPPPTAPVPRPEAVPGMRIVHEDTDIIVVDKPVGVVAHPTVGWTGPSVLEGLLAS
GVQVATSGAAERQGIVHRLDANTTGLMVVAKSETAYSVLKRAFKERTVDKHYHTLVQGHP
DPLRGTVDAPIDRHPAGDGRWAVVAGGRPSVTHYDTQEAFRAASLLEIKLETGRTHQIRV
HMSALRHPCVGDMLYGADPTLAERLGVRRQWLHAVRLGFDHPTEHRPVEFSSPYPDDLAA
AVETLRED
Download sequence
Identical sequences D7B0E9
WP_013151963.1.70090 WP_013151963.1.87825 gi|297559888|ref|YP_003678862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]