SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297559935|ref|YP_003678909.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559935|ref|YP_003678909.1|
Domain Number 1 Region: 524-926
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.89e-139
Family DNA polymerase I 0.0000000157
Further Details:      
 
Domain Number 2 Region: 20-190
Classification Level Classification E-value
Superfamily PIN domain-like 2.18e-49
Family 5' to 3' exonuclease catalytic domain 0.0000125
Further Details:      
 
Domain Number 3 Region: 191-304
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.64e-29
Family 5' to 3' exonuclease, C-terminal subdomain 0.00025
Further Details:      
 
Domain Number 4 Region: 336-518
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.18e-27
Family DnaQ-like 3'-5' exonuclease 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297559935|ref|YP_003678909.1|
Sequence length 928
Comment DNA polymerase I [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MVTKRETPDQTTRSGDGGRRPRLLLLDGHSMAFRAFFALPVDKFGTSTGQSTNAVYGFAS
MLVKLLRDEEPTHVAVAWDLSGPTFRHEEYAEYKDGRSDTPPEFPSQVPLTQDLMRLIGV
ANLSAPGFEADDVIATLAHQGGEAGMEVLIASGDRDAFQLVTDSCTVLYPGKSLSDLRRM
DPAAVEDKYGVTPERYRDLAALVGEKADNLPGVPGVGPKTAAKWITKYGSLDELVAHADE
LTGKAGQSFRDHLDDVLRNQRLNRLATDVELDAEVTALALGEADRTGIDALFDNLEFASN
LRERLYAVVRLPEDGSGETGTEAVEGFRVELTVAGTGELAPWLAAHAAPDDAASDTLTPT
APAGLALDGAWGQGTGRVDALAISVPSGDAVFVDPTALDPADTEALADFLADPRRPKAVH
EYKGALLALGAHGWELGGVVSDTALAAYLVQPGQRRFDLADLCRKYLGRELEEDSSGDQL
TLDLGGEDGAGSGRQHLLAVRASATRDLAGVLSAELDKRGGTHLLHEVELPLVDVLARLE
RAGIAADRPYLEELQGEFAAAGRVAVERAHEIVGREFNLGSPKQLQQVLFEDLGLPRTKK
IKTGYTTDADALAWLASQTDNELPAVLLHHRDQTKLRTTVEGLIKTVADDGRIHTTFNQT
VAATGRLSSTDPNLQNIPVRTDVGRRIRRAFVVGEGYEELLTADYSQIELRIMAHLSGEQ
ALIDAFNSGYDFHAQMAAQIFDVEVEQVDGEARSRIKAMSYGLAYGLSAYGLSQQLGITP
EESKRLMEDYFAEFGGVRDYLNAMVEEARRVGYTETILGRRRYLPDLTSDNRQRREMAER
MALNAPIQGSAADIIKVAMLRVDAALTEGGLTSRVLLQVHDELVVEVAPGERAEVENIVA
REMSSAYDLRVPLAVSVGSGQNWHDAAH
Download sequence
Identical sequences D7B0J6
gi|297559935|ref|YP_003678909.1| WP_013152010.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]