SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297560098|ref|YP_003679072.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560098|ref|YP_003679072.1|
Domain Number 1 Region: 7-140
Classification Level Classification E-value
Superfamily CheY-like 4.84e-36
Family CheY-related 0.00036
Further Details:      
 
Domain Number 2 Region: 157-223
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.33e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297560098|ref|YP_003679072.1|
Sequence length 229
Comment LuxR family transcriptional regulator [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MVPVNTPVRVLLVDDDPLVRSGLRIMLSGGGDIEVVGEAGDGAEVPAAVAEHRPDVVLMD
VRMPGTDGIAATEALRGDGSGPQVLVLTTFDADATVVRALRAGAAGYLLKHTAPERIVEA
VRRAAAGEPVLSPSVARALMDRVAGTDPVERTEAPSRRERARDRLALLTEREREVAEAVT
AGLSNAEIAERLYMSMGTVKAHVSSALTKLDLSGRVQLALLTHDARNPD
Download sequence
Identical sequences D7B1U5
gi|297560098|ref|YP_003679072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]