SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560115|ref|YP_003679089.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560115|ref|YP_003679089.1|
Domain Number 1 Region: 17-419
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-52
Family Cytochrome P450 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297560115|ref|YP_003679089.1|
Sequence length 421
Comment cytochrome P450 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MNHSPGPEAAAPASSGPPPPSPDHAGAARLYGPDIARDPAGLYEELRGRYGPVAPVLLDG
DVPAWFVMGYRELHHVTSRPEWFARDCRRWNQWDRVGRDWPLLPYVMWTPSVMFAEGAEH
QRRAGAIGDALDAVDRADLRTLCQRAADGLVDAFRAEGEADLVSQYAHRIPAMVVARLCG
LPEAEVPALVRDVVLSLDVAADAGGAHRRLHARLDALVADRRAAPRDDVPSRLLLHPAGL
SDAEAVIDLLVVLAAAQAPTGDWIGNTLLLMLTDDQFSLTLQGGRGSAGEALNEVLWKDT
PTQNFIGRWAVQACELGGRGIRRGDMLVLGLSAANADPRLHAGLPDVHSGNRAQMSFGHG
EHGCPFPAPEIAETIARTAVESLLDRLPDVRLAVPSERLEWRPSLWMRGLFELPARFTPQ
R
Download sequence
Identical sequences D7B1W2
WP_013152190.1.70090 gi|297560115|ref|YP_003679089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]