SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560125|ref|YP_003679099.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560125|ref|YP_003679099.1|
Domain Number 1 Region: 519-830
Classification Level Classification E-value
Superfamily Aldolase 2.93e-76
Family HMGL-like 0.00000134
Further Details:      
 
Domain Number 2 Region: 84-361
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.54e-70
Family BC ATP-binding domain-like 0.00000401
Further Details:      
 
Domain Number 3 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.12e-41
Family BC N-terminal domain-like 0.0000503
Further Details:      
 
Domain Number 4 Region: 827-992
Classification Level Classification E-value
Superfamily post-HMGL domain-like 6.28e-40
Family Conserved carboxylase domain 0.0017
Further Details:      
 
Domain Number 5 Region: 334-451
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.36e-35
Family BC C-terminal domain-like 0.0000993
Further Details:      
 
Domain Number 6 Region: 1050-1125
Classification Level Classification E-value
Superfamily Single hybrid motif 8.38e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297560125|ref|YP_003679099.1|
Sequence length 1126
Comment pyruvate carboxylase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MFRKVLVANRGEIAIRALRAGYELGARTVAVFPHEDRGSLHRLKADEAYQIGEPGHPVRA
YLSVDEIVGAARRAGADAVYPGYGFLSENPELARACERAGITFVGPPADVLELTGNKASA
VAAAREAGVPVLESSEPSDDVEALVAAAERIGFPLFVKAVAGGGGRGMRRVQEPERLREA
VEAAMREASAAFGDATVFLERAVVDPRHIEVQILADGEGGVVHLYERDCSLQRRHQKVIE
LAPAPNLDPDLRDRICADAVRFARRIGYRNAGTVEFLVGADGSHVFIEMNPRIQVEHTVT
EEITDVDLVQSQLRIASGETLSDLGISQEGVYVRGAALQCRITTEDPANGFRPDTGTISA
YRSPGGSGIRLDGGTSAAGTEISPHFDSLLVKLTCRGRDLATAVSRARRAVAEFRIRSIA
TNIPFLQAVLDDPDFQAGRITTSFIEERPHLLTARPSADRGTRLLTYLADVTVNKPHGER
PQLVDPATKLPPLPEPAGPPPPGSRQRLAELGPEGFARWLRESPNLGVTDTTFRDAHQSL
LATRVRTRDLLAAAPAVAHTLPELLSLECWGGATYDVALRFLAEDPWERLAALREAVPNI
CLQMLLRGRNTVGYTPYPTEVTDAFVREAAETGVDVFRIFDALNDVEQMRPAIEAVRATG
TSVAEVALCYTSDLSDPGEKLYTLDYYLKLAERIVDAGAHVLAIKDMAGLLRAPAAAKLV
TALRSEFDLPVHVHTHDTPGGQLATYLAAVNAGADAVDGAVASMAGTTSQPSLSAIVAAF
DHSEHSTGLSLDAVNELEPYWEAVRRVYAPFEAGLSSPTGRVYHHEIPGGQLSNLRTQAV
ALGLGEHFEEIEAMYGAADRMLGHLVKVTPSSKVVGDLALHLVGAGVSPADFEADPGRFD
VPDSVVGFLRGELGVPPGGWPEPLRTRALQGRSEARPAQELSEQDRAGLAEDRRATLNRL
LFPGPTREFEEHRAAYGDTSVLSSADFFYGLRAGEEYAVDLSPGVRLLIQLEAVGEADER
GVRTVMATLNDQLRPLQIRDRALASQVRSAEKADRSDPGQVAAPFAGAVTLTVAEGEAVE
AGATVATIEAMKMEAAITAPVSGTVTRVAVDRVQKVEGGDLLVCLG
Download sequence
Identical sequences D7B1X2
WP_013152200.1.70090 gi|297560125|ref|YP_003679099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]